PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g093170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 300aa    MW: 33007.2 Da    PI: 7.2242
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g093170.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+lv  +++ G g+W+t ++  g+ R++k+c++rw +yl
   Csa05g093170.1 14 KGPWTADEDEILVAHIQKNGHGSWRTLPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.98.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
   Csa05g093170.1  67 RGPFTAEEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.671961IPR017930Myb domain
SuperFamilySSF466895.87E-3011108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002494.1E-141461IPR001005SANT/Myb domain
CDDcd001677.35E-101661No hitNo description
PROSITE profilePS5129425.64762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665116IPR009057Homeodomain-like
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.02E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTAD EDEILVAHIQ KNGHGSWRTL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TAEEEKLVVQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSMG  120
LDPKTHEPVT SFGLPKQAPS SPTTRHMAQW ESARVEAEAR LSRESMLFCP SSAGGAVKTD  180
CDHFLRIWNS EIGEAFRNLA PLDESTTTSQ SPCSRTTSSS SALQKSSTKS FGGKEVVTVA  240
IHGSEYSPCS NNLEDDSTDS ALQLLLDFPI SDDDMSFLEE NIDSYTESHV GVVSMGSKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196010.0AY519601.1 Arabidopsis thaliana MYB transcription factor (At3g61250) mRNA, complete cds.
GenBankBT0331290.0BT033129.1 Arabidopsis thaliana unknown protein (At3g61250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010512459.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLR0H7220.0R0H722_9BRAS; Uncharacterized protein
STRINGAT3G61250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-180myb domain protein 17